PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_F1B450FA4.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 732aa    MW: 79145.6 Da    PI: 4.5876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_F1B450FA4.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.2e-143074348
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +W++eEd+ l   ++ +G+++W+ Ia  +   +t+ qc+ rw++yl
  Traes_2BS_F1B450FA4.2 30 SWSAEEDDVLRAQIAHHGTDNWTVIATQFK-DKTARQCRRRWYNYL 74
                           6****************************9.**************7 PP

2Myb_DNA-binding41.23.9e-1380123146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +g W+ eEd ll +a k+lG++ W+ Ia+ +  gRt++ +k+r+ +
  Traes_2BS_F1B450FA4.2  80 KGGWSREEDMLLCEAQKLLGNK-WTEIAKVVS-GRTDNAVKNRFST 123
                            688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.242378IPR017930Myb domain
SMARTSM007176.3E-132776IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-2627121IPR009057Homeodomain-like
CDDcd001677.79E-133074No hitNo description
PfamPF139213.5E-153191No hitNo description
Gene3DG3DSA:1.10.10.602.0E-193181IPR009057Homeodomain-like
PROSITE profilePS5129416.98879129IPR017930Myb domain
SMARTSM007171.3E-1379127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-1982128IPR009057Homeodomain-like
CDDcd001671.19E-983124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MATGPDLTSP SAADAAAASS AAKKDRHIVS WSAEEDDVLR AQIAHHGTDN WTVIATQFKD  60
KTARQCRRRW YNYLNTECKK GGWSREEDML LCEAQKLLGN KWTEIAKVVS GRTDNAVKNR  120
FSTLCKRRAK DDELLEENGT VCSNASAKRV LTQSGGVTCA APGSSPPIKN MSSCKPDFKE  180
NLAPNMRSFG QQKSIRQDSR QPLASICPDN QSVNIVKTQS LVTKTSTKQL HGEEQSCVKH  240
DGNFLKRNDP KLATLLQQAD LLSSLATKVN TENTSQSMDE AWQKLQHHLV KKDDNDMSES  300
SMSGTASLLD DLDDLIVDPY ENEEEDEQKS REQNGATSQV APDQIMDNCP VDQIAEESSL  360
CGNTLSSTME PCPVAEILAH INLGEAAEDM GLHFMEYSSP THAAQAQQAK ADAEIPASVD  420
LSESAEVQAQ QAKADAEIPV SVDLSEAAEG SWSQFMEYTS PAHTVLHAEG DAETPASVKL  480
SEAAEGSLPQ CMEHMSPAHT LLRAKTDSEI PASANSNEAA EGSWSQFMEY MSPAHIVLHA  540
KADAETPASV NLGEAAEGSL PQCMEPMSPA HTLLRAKTDY EIPASANLSE AAKDDSLQCT  600
EYTSPARADL QANADAEISE DFSEVAQDSR LQCAKFTSPA HTAIKGKAVA KKGTSENCSD  660
VPEDSSTQPC MEFTSPAHTV PTFHPFTDNV PTPKITASER NFLLSVLELA SPGSKPETSQ  720
QPSCKRALLN SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-293112810107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519130.0JF951913.1 Triticum carthlicum clone TaMYB30 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235205.10.0PREDICTED: uncharacterized protein LOC100835080 isoform X1
TrEMBLW5BPZ90.0W5BPZ9_WHEAT; Uncharacterized protein
STRINGMLOC_9840.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.13e-70myb domain protein 88
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]